PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0605s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 342aa    MW: 36832.7 Da    PI: 7.8644
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0605s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-393090262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            +e+a+kcprC+s ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  SapurV1A.0605s0090.1.p 30 QEQASKCPRCESPNTKFCYYNNYSLAQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 90
                            57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253188IPR003851Zinc finger, Dof-type
PfamPF027017.6E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8173488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVPPVDLQET SKDDNQSSTS NRKTATTRPQ EQASKCPRCE SPNTKFCYYN NYSLAQPRHF  60
CKTCRRYWTK GGALRNVPIG GGCRKNKKIK SSTRLSSESK DSTGSLEISG FNFFHGLSPT  120
VDFNLGGLSL PRLNPSQNGL YSHFPSFGDT SAAAVTVTSP CFSLDPSVSS TAGSCSLMGL  180
NYPLTSVTNR FCNAIQENIG GGSMNVNTNL PSSIESLSCI NQDLHWKLQQ QRLAMLYGTG  240
ENHKDGSTVS TDPIDQSLGH KPQPIMFENL EISKPQVCAA GNPGKEGAAS GDTATEWFFG  300
NSYSQVTATP TNASNNGNND NTGNWNGVQA WGDLHQYSVL P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380583.10.0hypothetical protein POPTR_0007s09520g
TrEMBLU5G4P20.0U5G4P2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19310.11e-163(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-60Dof family protein